Loading...
Statistics
Advertisement

Sheltonshire.com

Advertisement
Sheltonshire.com is hosted in United States / Provo . Sheltonshire.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.10.1.

Technologies in use by Sheltonshire.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/1.10.1

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Sheltonshire.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by BlueHost.Com, INC/OU=PositiveSSL Wildcard/CN=*.bluehost.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by BlueHost.Com, INC
        • 2: PositiveSSL Wildcard
      • CN: *.bluehost.com
    • hash: b00471fb
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 275919344465328667035358918366332841359
    • validFrom: 150313000000Z
    • validTo: 180312235959Z
    • validFrom_time_t: 1426204800
    • validTo_time_t: 1520899199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 29:B6:2F:A5:A8:41:C7:45:BE:86:84:10:E9:26:A7:94:67:64:BC:73
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.bluehost.com, DNS:bluehost.com

Meta - Sheltonshire.com

Number of occurences: 1
  • Name:
    Content: 0;url= Sheltonshire/Home.html

Server / Hosting

  • IP: 69.89.31.167
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

Rname

  • ns1.bluehost.com
  • ns2.bluehost.com
  • fallbackmx.spamexperts.eu
  • mx.spamexperts.com
  • lastmx.spamexperts.net

Target

  • dnsadmin.box367.bluehost.com

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Tue, 14 Jun 2016 14:04:41 GMT Content-Type: text/html Content-Length: 319 Last-Modified: Sun, 18 Apr 2010 20:32:23 GMT Accept-Ranges: bytes Vary: Accept-Encoding X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

DNS

host: sheltonshire.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 69.89.31.167
host: sheltonshire.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bluehost.com
host: sheltonshire.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bluehost.com
host: sheltonshire.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.bluehost.com
  5. rname: dnsadmin.box367.bluehost.com
  6. serial: 2016010302
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 300
host: sheltonshire.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 20
  5. target: fallbackmx.spamexperts.eu
host: sheltonshire.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: mx.spamexperts.com
host: sheltonshire.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 30
  5. target: lastmx.spamexperts.net
host: sheltonshire.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:bluehost.com ?all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.heltonshire.com, www.seheltonshire.com, www.eheltonshire.com, www.swheltonshire.com, www.wheltonshire.com, www.sdheltonshire.com, www.dheltonshire.com, www.sxheltonshire.com, www.xheltonshire.com, www.sfheltonshire.com, www.fheltonshire.com, www.sgheltonshire.com, www.gheltonshire.com, www.stheltonshire.com, www.theltonshire.com, www.seltonshire.com, www.sheeltonshire.com, www.seeltonshire.com, www.shdeltonshire.com, www.sdeltonshire.com, www.shceltonshire.com, www.sceltonshire.com, www.shueltonshire.com, www.sueltonshire.com, www.shjeltonshire.com, www.sjeltonshire.com, www.sheltonshire.com, www.seltonshire.com, www.shbeltonshire.com, www.sbeltonshire.com, www.shgeltonshire.com, www.sgeltonshire.com, www.shltonshire.com, www.shexltonshire.com, www.shxltonshire.com, www.shesltonshire.com, www.shsltonshire.com, www.shewltonshire.com, www.shwltonshire.com, www.sherltonshire.com, www.shrltonshire.com, www.shefltonshire.com, www.shfltonshire.com, www.shevltonshire.com, www.shvltonshire.com, www.shecltonshire.com, www.shcltonshire.com, www.sheqltonshire.com, www.shqltonshire.com, www.shealtonshire.com, www.shaltonshire.com, www.sheyltonshire.com, www.shyltonshire.com, www.shetonshire.com, www.shelutonshire.com, www.sheutonshire.com, www.shel8tonshire.com, www.she8tonshire.com, www.shel9tonshire.com, www.she9tonshire.com, www.sheljtonshire.com, www.shejtonshire.com, www.shel0tonshire.com, www.she0tonshire.com, www.shelmtonshire.com, www.shemtonshire.com, www.shelptonshire.com, www.sheptonshire.com, www.shelotonshire.com, www.sheotonshire.com, www.shelonshire.com, www.sheltqonshire.com, www.shelqonshire.com, www.sheltaonshire.com, www.shelaonshire.com, www.shelt onshire.com, www.shel onshire.com, www.sheltwonshire.com, www.shelwonshire.com, www.shelteonshire.com, www.sheleonshire.com, www.sheltzonshire.com, www.shelzonshire.com, www.sheltxonshire.com, www.shelxonshire.com, www.sheltconshire.com, www.shelconshire.com, www.sheltnshire.com, www.sheltobnshire.com, www.sheltbnshire.com, www.sheltohnshire.com, www.shelthnshire.com, www.sheltognshire.com, www.sheltgnshire.com, www.sheltojnshire.com, www.sheltjnshire.com, www.sheltomnshire.com, www.sheltmnshire.com, www.shelto nshire.com, www.shelt nshire.com, www.sheltovnshire.com, www.sheltvnshire.com, www.sheltoshire.com, www.sheltonnshire.com, www.sheltonshire.com, www.sheltonhshire.com, www.sheltohshire.com, www.sheltonjshire.com, www.sheltojshire.com, www.sheltonkshire.com, www.sheltokshire.com, www.sheltonlshire.com, www.sheltolshire.com, www.shelton shire.com, www.shelto shire.com, www.sheltonhire.com, www.sheltonsehire.com, www.sheltonehire.com, www.sheltonswhire.com, www.sheltonwhire.com, www.sheltonsdhire.com, www.sheltondhire.com, www.sheltonsxhire.com, www.sheltonxhire.com, www.sheltonsfhire.com, www.sheltonfhire.com, www.sheltonsghire.com, www.sheltonghire.com, www.sheltonsthire.com, www.sheltonthire.com, www.sheltonsire.com, www.sheltonsheire.com, www.sheltonseire.com, www.sheltonshdire.com, www.sheltonsdire.com, www.sheltonshcire.com, www.sheltonscire.com, www.sheltonshuire.com, www.sheltonsuire.com, www.sheltonshjire.com, www.sheltonsjire.com, www.sheltonshire.com, www.sheltonsire.com, www.sheltonshbire.com, www.sheltonsbire.com, www.sheltonshgire.com, www.sheltonsgire.com, www.sheltonshre.com, www.sheltonshirre.com, www.sheltonshrre.com, www.sheltonshifre.com, www.sheltonshfre.com, www.sheltonshivre.com, www.sheltonshvre.com, www.sheltonshikre.com, www.sheltonshkre.com, www.sheltonshi,re.com, www.sheltonsh,re.com, www.sheltonshibre.com, www.sheltonshbre.com, www.sheltonshigre.com, www.sheltonshgre.com, www.sheltonshitre.com, www.sheltonshtre.com, www.sheltonshiyre.com, www.sheltonshyre.com, www.sheltonshiure.com, www.sheltonshure.com, www.sheltonshijre.com, www.sheltonshjre.com, www.sheltonshimre.com, www.sheltonshmre.com, www.sheltonshinre.com, www.sheltonshnre.com,

Other websites we recently analyzed

  1. et-s.cn
    Kowloon (Hong Kong) - 123.1.149.57
    Server software: squid/3.5.12
    Technology: Html, Html5, Javascript
    Number of meta tags: 1
  2. vippscanadianpharmacyreviews.ru
    vippscanadianpharmacyreviews.ru
    Saint Louis (United States) - 69.64.32.180
    Server software: nginx/1.1.19
    Technology: Html
    Number of meta tags: 2
  3. Bob the BA - Business Analysis Training
    Business Analysis Training for Business Analysts Project Managers and Project Professionals
    New York (United States) - 198.185.159.145
    Server software: Protected by COMODO WAF mod_bwlimited/1.4
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
    Number of Javascript: 2
    Number of meta tags: 9
  4. 8997357.com
    Cheyenne (United States) - 23.224.74.159
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Javascript, SVG
    Number of Javascript: 13
    Number of meta tags: 5
  5. skagen-mtb.dk
    Copenhagen (Denmark) - 212.97.133.111
    Server software: Microsoft-IIS/7.0
    Technology: Html
    Number of meta tags: 1
  6. Manto Gallery
    New York (United States) - 198.49.23.145
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 3
    Number of meta tags: 7
  7. janeemitchell.co.uk
    Houston (United States) - 173.193.106.11
    Server software: nginx
    Technology: Html
  8. golfonline.hu
    Hungary - 88.151.96.8
    Server software: Tengine
    Technology: Php
  9. remembertobreathemylove.com
    Los Angeles (United States) - 208.73.210.217
    Server software: Apache
    Technology: Html
  10. Styrolit | A SYNBRA COMPANY
    Denmark - 46.30.212.149
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 7
    Number of meta tags: 2

Check Other Websites